Semaglutide is a long-acting GLP-1 receptor agonist widely referenced in metabolic and incretin-signalling research. Supplied as a lyophilized powder for laboratory research applications only.
Specifications
| CAS number | 910463-68-2 |
|---|---|
| Molecular formula | C187H291N45O59 |
| Molecular weight | 4113.58 g/mol |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (modified) |
| Purity | ≥99% |
| Appearance | Lyophilized white powder |
| Form | Lyophilized powder |
| Storage | Store lyophilized at -20°C, protect from light. |
| Reconstitution | Reconstitute with bacteriostatic or sterile water; keep refrigerated after reconstitution. |
| Research areas | Metabolic signalling, Endocrinology, Incretin research |
Research Use Only. This product is intended strictly for laboratory research. Not for human or veterinary use, food, or drug applications.
Editorial standard
North Specs separates scientific education from product claims. Review primary literature, current regulations and institutional requirements before designing laboratory work.