Skip to content

Strictly for laboratory Research Use Only

NORTHSPECS LABS

Catalogue search

Find a research compound

Semaglutide

Price range: $89.00 through $159.00

GLP-1 receptor agonist · Purity ≥99%.

For laboratory research use only.

Free dispatch across Canada on orders over $150.00.

Research Use OnlyNot for human or veterinary use.

Batch documentationRequest the record associated with an exact lot.

Protected dispatchSecurely packed in Canada.

SKU: N/A Category:

Responsible procurement

Strictly for controlled laboratory research

Purchasers confirm that they are qualified researchers, laboratories or research institutions and understand that North Specs Labs products are not intended for human consumption, diagnostic, therapeutic or medical use.

Documentation matched to the supplied lot

Use the batch identifier on the product label or order record. Public records appear only after verification; exact documents can also be requested from research support.

Shipping
Canada only; tracking is emailed after dispatch.
Payment
Dispatch begins after cleared payment or approved institutional terms.

Description

Semaglutide is a long-acting GLP-1 receptor agonist widely referenced in metabolic and incretin-signalling research. Supplied as a lyophilized powder for laboratory research applications only.

Specifications

CAS number 910463-68-2
Molecular formula C187H291N45O59
Molecular weight 4113.58 g/mol
Sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG (modified)
Purity ≥99%
Appearance Lyophilized white powder
Form Lyophilized powder
Storage Store lyophilized at -20°C, protect from light.
Reconstitution Reconstitute with bacteriostatic or sterile water; keep refrigerated after reconstitution.
Research areas Metabolic signalling, Endocrinology, Incretin research

Research Use Only. This product is intended strictly for laboratory research. Not for human or veterinary use, food, or drug applications.

Additional information

Size

5 mg, 10 mg

Institutional research

Need documentation or volume support?

Talk with our research support team about batch records, institutional procurement and catalogue availability.

Start a research request